Return to main results Retrieve Phyre Job Id

Job DescriptionP0CF89
Confidence91.50%DateThu Jan 5 11:31:47 GMT 2012
Rank146Aligned Residues49
% Identity14%Templatec2ebyA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:putative hth-type transcriptional regulator ybaq; PDBTitle: crystal structure of a hypothetical protein from e. coli
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70.........80.........90.
Predicted Secondary structure 






























Query SS confidence 









































































Query Sequence  KNGTGFSEIANILGSKPGTIFTMLRDTGGIKPHERKRAVAHLTLSEREEIRAGLSAKMSIRAIATALNRSPSTI
Query Conservation    
     

   

       
                  

  

  
  
     
 
 

  

   


Alig confidence 






















..










.......................














Template Conservation    



 


   


   

  ..
 
   

   .......................
 


  
 

   
Template Sequence  PLDLKINELAELLHVHRNSVSAL. . INNNRKLTTEM. . . . . . . . . . . . . . . . . . . . . . . AFRLAKVFDTTVDFW
Template Known Secondary structure  TTT

TS
..TTSS


.......................T

Template Predicted Secondary structure 






..




.......................


Template SS confidence 









































































   2930.........40.........50. ........60.. .......70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions