Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB31
Confidence1.32%DateThu Jan 5 11:14:29 GMT 2012
Rank81Aligned Residues29
% Identity21%Templatec3djmA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:uncharacterized protein duf427; PDBTitle: crystal structure of a protein of unknown function from duf427 family2 (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a3 resolution
Resolution2.51 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30........ .40. .......
Predicted Secondary structure 













..


.......



Query SS confidence 


















. .


. . . . . . .






Query Sequence  ISRTIPGQGHGNQYYPGVQ. . WDV. . . . . . . RDSAWRY
Query Conservation 
  
    
    

 


.. 
 ....... 
     
Alig confidence 


















..


.......






Template Conservation     
  
   
 

 

 
 
  
         


 
Template Sequence  XVXFDKSEKVTACPLKGEASYYSIVGASGTLKDAAWSY
Template Known Secondary structure  GGGTTTTT
Template Predicted Secondary structure 




















Template SS confidence 





































   52.......60.........70.........80.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions