Return to main results Retrieve Phyre Job Id

Job DescriptionP76063
Confidence84.51%DateThu Jan 5 12:18:02 GMT 2012
Rank102Aligned Residues29
% Identity21%Templatec2rn7A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:is629 orfa; PDBTitle: nmr solution structure of tnpe protein from shigella2 flexneri. northeast structural genomics target sfr125
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910..... ....20.........30.......
Predicted Secondary structure  ...........




Query SS confidence 






. . . . . . . . . . .





















Query Sequence  KQACAVV. . . . . . . . . . . GGQSAMARLLGVSPPSVNQWIK
Query Conservation   


   ...........



 


 




  



  
Alig confidence 






...........





















Template Conservation    

 

 
        
 
   

  


   

  


Template Sequence  QRAVRMVLESQGEYDSQWATICSIAPKIGCTPETLRVWVR
Template Known Secondary structure 


TS
Template Predicted Secondary structure 











Template SS confidence 







































   13......20.........30.........40.........50..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions