Return to main results Retrieve Phyre Job Id

Job DescriptionP76537
Confidence12.94%DateThu Jan 5 12:24:07 GMT 2012
Rank21Aligned Residues39
% Identity33%Templatec1s1hI_
PDB info PDB header:ribosomeChain: I: PDB Molecule:40s ribosomal protein s16; PDBTitle: structure of the ribosomal 80s-eef2-sordarin complex from2 yeast obtained by docking atomic models for rna and protein3 components into a 11.7 a cryo-em map. this file, 1s1h,4 contains 40s subunit. the 60s ribosomal subunit is in file5 1s1i.
Resolution11.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.........50.........60....
Predicted Secondary structure 

































Query SS confidence 




















































Query Sequence  PLMLTGCSTMSSVNWSAANPWNWFGSSTKVSEQGVGELTASTPLQEQAIADAL
Query Conservation   


 


  
  


 
 
  

 
 
 

  


 


 

  
 

  

Alig confidence 












.............







.

















Template Conservation 

 
         .............

 
 
 
.

  


 


 





Template Sequence  PLLLVGLDKFSNI. . . . . . . . . . . . . DIRVRVTG. GGHVSQVYAIRQAIAKGL
Template Known Secondary structure  TSS
TTTT
.............
S.S
Template Predicted Secondary structure 








.............

.



Template SS confidence 




















































   50.........60.. .......70 .........80........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions