Return to main results Retrieve Phyre Job Id

Job DescriptionP38489
Confidence18.78%DateThu Jan 5 11:58:09 GMT 2012
Rank51Aligned Residues32
% Identity19%Templatec2p1nD_
PDB info PDB header:signaling proteinChain: D: PDB Molecule:skp1-like protein 1a; PDBTitle: mechanism of auxin perception by the tir1 ubiqutin ligase
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   150.........160... ......170.........180.
Predicted Secondary structure 



..........








Query SS confidence 













. . . . . . . . . .

















Query Sequence  FLLGVAALGLDAVP. . . . . . . . . . IEGFDAAILDAEFGLKEK
Query Conservation    


   



  ..........
       
   
 

  
Alig confidence 













..........

















Template Conservation 

 




 
  



 
  

  
 


 



  


  
Template Sequence  LILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKND
Template Known Secondary structure  T
TT

S




Template Predicted Secondary structure 









Template SS confidence 









































   101........110.........120.........130.........140..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions