Return to main results Retrieve Phyre Job Id

Job DescriptionP77806
Confidence29.14%DateThu Jan 5 12:33:00 GMT 2012
Rank332Aligned Residues52
% Identity23%Templatec3pzvB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:endoglucanase; PDBTitle: c2 crystal form of the endo-1,4-beta-glucanase from bacillus subtilis2 168
Resolution2.87 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   127..130.........140.........150.........160.........170.........180.........190.........200..
Predicted Secondary structure 
































Query SS confidence 











































































Query Sequence  SYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISD
Query Conservation           
  
  
                               



          
   
      

 
Alig confidence 






























........................




















Template Conservation           
 
 


               ........................   

  
  
   

 



Template Sequence  SLKWLRDDWGITVFRAAMYTADGGYIDNPSV. . . . . . . . . . . . . . . . . . . . . . . . KNKVKEAVEAAKELGIYVIID
Template Known Secondary structure  TS

SSSTTSTTT
GGG........................T
Template Predicted Secondary structure 














........................


Template SS confidence 











































































   78.80.........90.........100........ .110.........120.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions