Return to main results Retrieve Phyre Job Id

Job DescriptionP77806
Confidence20.20%DateThu Jan 5 12:33:00 GMT 2012
Rank374Aligned Residues41
% Identity24%Templatec1pklB_
PDB info PDB header:transferaseChain: B: PDB Molecule:protein (pyruvate kinase); PDBTitle: the structure of leishmania pyruvate kinase
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   329330.........340.........350.........360.........370. ........380.....
Predicted Secondary structure 

















.
Query SS confidence 










































.













Query Sequence  VSTLDDVEFCQWLTQEHGVAAIPLSVFCADPFPHKLIRLCFAK. KESTLLAAAERLRQ
Query Conservation              

   

 
 

  
         



   .  
 
  

 

 
Alig confidence 














.




...............






.













Template Conservation 



   
 
  

 .

  
............... 


 


  
     
  

 
Template Sequence  GPSTQSVEALKGLIQ. SGMSV. . . . . . . . . . . . . . . ARMNFSHGSHEYHQTTINNVRQ
Template Known Secondary structure 
TTT
S.T...............TTSS
Template Predicted Secondary structure 





.



...............




Template SS confidence 

























































   28.30.........40.. ..... ..50.........60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions