Return to main results Retrieve Phyre Job Id

Job DescriptionP77806
Confidence25.63%DateThu Jan 5 12:33:00 GMT 2012
Rank351Aligned Residues42
% Identity17%Templatec1aqfB_
PDB info PDB header:transferaseChain: B: PDB Molecule:pyruvate kinase; PDBTitle: pyruvate kinase from rabbit muscle with mg, k, and l-2 phospholactate
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   329330.........340.........350.........360.........370. ........380......
Predicted Secondary structure 

















.

Query SS confidence 










































.














Query Sequence  VSTLDDVEFCQWLTQEHGVAAIPLSVFCADPFPHKLIRLCFAK. KESTLLAAAERLRQL
Query Conservation              

   

 
 

  
         



   .  
 
  

 

 

Alig confidence 














.




...............






.














Template Conservation 



   
 
  

 .

  
............... 


 


  
     
  

  
Template Sequence  GPASRSVETLKEMIK. SGMNV. . . . . . . . . . . . . . . ARMNFSHGTHEYHAETIKNVRTA
Template Known Secondary structure 
TTS
S.T

...............TTS

Template Predicted Secondary structure 





.



...............




Template SS confidence 


























































   51........60..... ....70 .........80.........90...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions