Return to main results Retrieve Phyre Job Id

Job DescriptionP08192
Confidence24.96%DateThu Jan 5 11:00:51 GMT 2012
Rank315Aligned Residues36
% Identity33%Templated3dhwc1
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases ABC transporter ATPase domain-like
Resolution3.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51...... ..60.........70.........80.........90.........100.
Predicted Secondary structure 

..


















Query SS confidence 






. .











































Query Sequence  VFTVAGT. . NGKGTTCRTLESILMAAGYKVGVYSSPHLVRYTERVRVQGQELP
Query Conservation 

 



..





  

  

   
  

  


 
    
 
 
 
  
 
Alig confidence 






..
















...............











Template Conservation 
  


 








  
 
     ............... 
 
   
  
 
Template Sequence  IYGVIGASGAGKSTLIRCVNLLERPT. . . . . . . . . . . . . . . EGSVLVDGQELT
Template Known Secondary structure  STTSSTTSS

S...............TT
Template Predicted Secondary structure 










...............





Template SS confidence 




















































   33......40.........50........ .60.........70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions