Return to main results Retrieve Phyre Job Id

Job DescriptionP08192
Confidence51.87%DateThu Jan 5 11:00:51 GMT 2012
Rank217Aligned Residues36
% Identity25%Templatec3gd7C_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:fusion complex of cystic fibrosis transmembrane PDBTitle: crystal structure of human nbd2 complexed with n6-2 phenylethyl-atp (p-atp)
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51........ 60.........70.........80.........90.........100..
Predicted Secondary structure 



..
















Query SS confidence 








. .










































Query Sequence  VFTVAGTNG. . KGTTCRTLESILMAAGYKVGVYSSPHLVRYTERVRVQGQELPE
Query Conservation 

 





..



  

  

   
  

  


 
    
 
 
 
  
  
Alig confidence 








..















................










Template Conservation     
 
 








  



    
................ 
   
     
Template Sequence  RVGLLGRTGSGKSTLLSAFLRLLNTEG. . . . . . . . . . . . . . . . EIQIDGVSWDS
Template Known Secondary structure 
TTSSTT
S................TTSSS
Template Predicted Secondary structure 












................




Template SS confidence 





















































   12391240.........1250.........1260..... ....1270......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions