Return to main results Retrieve Phyre Job Id

Job DescriptionP08192
Confidence53.48%DateThu Jan 5 11:00:51 GMT 2012
Rank212Aligned Residues36
% Identity22%Templatec3fvqB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:fe(3+) ions import atp-binding protein fbpc; PDBTitle: crystal structure of the nucleotide binding domain fbpc2 complexed with atp
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50......... 60.........70.........80.........90.........100
Predicted Secondary structure 




..















Query SS confidence 









. .








































Query Sequence  FVFTVAGTNG. . KGTTCRTLESILMAAGYKVGVYSSPHLVRYTERVRVQGQEL
Query Conservation   

 





..



  

  

   
  

  


 
    
 
 
 
  
Alig confidence 









..














...............










Template Conservation 
   


 








  
 
     ............... 
 
   
  
Template Sequence  EILFIIGASGCGKTTLLRCLAGFEQPD. . . . . . . . . . . . . . . SGEISLSGKTI
Template Known Secondary structure 
STTSSTSS

S...............TT
Template Predicted Secondary structure 












...............




Template SS confidence 




















































   31........40.........50....... ..60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions