Return to main results Retrieve Phyre Job Id

Job DescriptionP08192
Confidence21.10%DateThu Jan 5 11:00:51 GMT 2012
Rank341Aligned Residues36
% Identity25%Templatec2ghiD_
PDB info PDB header:transport proteinChain: D: PDB Molecule:transport protein; PDBTitle: crystal structure of plasmodium yoelii multidrug resistance2 protein 2
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51....... .60.........70.........80.........90.........100..
Predicted Secondary structure 


..

















Query SS confidence 







. .











































Query Sequence  VFTVAGTN. . GKGTTCRTLESILMAAGYKVGVYSSPHLVRYTERVRVQGQELPE
Query Conservation 

 




..




  

  

   
  

  


 
    
 
 
 
  
  
Alig confidence 







..
















................










Template Conservation     
 
 








  
 
     
................ 
   
     
Template Sequence  TCALVGHTGSGKSTIAKLLYRFYDAEG. . . . . . . . . . . . . . . . DIKIGGKNVNK
Template Known Secondary structure 
STTSSTTSS

................TTGGG
Template Predicted Secondary structure 











................









Template SS confidence 





















































   48.50.........60.........70.... .....80.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions