Return to main results Retrieve Phyre Job Id

Job DescriptionP08192
Confidence42.18%DateThu Jan 5 11:00:51 GMT 2012
Rank246Aligned Residues38
% Identity16%Templatec1q1bD_
PDB info PDB header:transport proteinChain: D: PDB Molecule:maltose/maltodextrin transport atp-binding protein malk; PDBTitle: crystal structure of e. coli malk in the nucleotide-free form
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50......... 60.........70.........80.........90.........100..
Predicted Secondary structure 




..
















Query SS confidence 









. .










































Query Sequence  FVFTVAGTNG. . KGTTCRTLESILMAAGYKVGVYSSPHLVRYTERVRVQGQELPE
Query Conservation   

 





..



  

  

   
  

  


 
    
 
 
 
  
  
Alig confidence 









..














...............












Template Conservation 

  
 
 








  
 

  
 ............... 
 
   
  
  
Template Sequence  EFVVFVGPSGCGKSTLLRMIAGLETIT. . . . . . . . . . . . . . . SGDLFIGEKRMND
Template Known Secondary structure 

SGGGSTTTSS


...............SSTT
TT
Template Predicted Secondary structure 












...............






Template SS confidence 






















































   30.........40.........50...... ...60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions