Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAR5
Confidence3.64%DateThu Jan 5 11:13:34 GMT 2012
Rank73Aligned Residues24
% Identity17%Templatec2ig3A_
PDB info PDB header:oxygen storage/transportChain: A: PDB Molecule:group iii truncated haemoglobin; PDBTitle: crystal structure of group iii truncated hemoglobin from campylobacter2 jejuni
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60 .......
Predicted Secondary structure 



........

Query SS confidence 
















. . . . . . . .






Query Sequence  PRFHAWLLYRSWFGSYL. . . . . . . . RFWQKHH
Query Conservation 

   

  
   

 
........  
    
Alig confidence 
















........






Template Conservation    

  
  
  
 
 
         
     
Template Sequence  EIFYEKVRKDKDLGPIFNNAIGTSDEEWKEHK
Template Known Secondary structure 
TT
SS
Template Predicted Secondary structure 







Template SS confidence 































   16...20.........30.........40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions