Return to main results Retrieve Phyre Job Id

Job DescriptionP22188
Confidence20.58%DateThu Jan 5 11:38:45 GMT 2012
Rank445Aligned Residues39
% Identity28%Templated1e94e_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Extended AAA-ATPase domain
Resolution2.8

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   92.......100... ......110.........120.........130.
Predicted Secondary structure 

..............







Query SS confidence 











. . . . . . . . . . . . . .



























Query Sequence  ERLSALAGRFYH. . . . . . . . . . . . . . EPSDNLRLVGVTGTNGKTTTTQLLAQWS
Query Conservation   

  

     ..............       

 









  

  

Alig confidence 











..............













.












Template Conservation   
   

 

  
  
            
 



 




.


 





  
Template Sequence  NAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTGV. GKTEIARRLAKLA
Template Known Secondary structure  TS







TTS.STTT
Template Predicted Secondary structure 

















.

Template SS confidence 





















































   22.......30.........40.........50.........60. ........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions