Return to main results Retrieve Phyre Job Id

Job DescriptionP39379
Confidence1.45%DateThu Jan 5 12:00:11 GMT 2012
Rank22Aligned Residues29
% Identity31%Templatec1powA_
PDB info PDB header:oxidoreductase(oxygen as acceptor)Chain: A: PDB Molecule:pyruvate oxidase; PDBTitle: the refined structures of a stabilized mutant and of wild-type2 pyruvate oxidase from lactobacillus plantarum
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   95....100.........110.........120.........130.....
Predicted Secondary structure 





Query SS confidence 








































Query Sequence  GIISITDGLGGLRAAQQLMTPVLKPLLGIPGICSLALIANL
Query Conservation      


  
 
     
  
 
  





 
 
 

 

Alig confidence 










............

















Template Conservation   
   
   

............  


 

     
  

Template Sequence  AVIKVLEAWGV. . . . . . . . . . . . DHLYGIPGGSINSIMDAL
Template Known Secondary structure  TT
............



GGG
Template Predicted Secondary structure 


............






Template SS confidence 








































   16...20...... ...30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions