Return to main results Retrieve Phyre Job Id

Job DescriptionQ46809
Confidence84.68%DateThu Jan 5 12:34:36 GMT 2012
Rank464Aligned Residues35
% Identity29%Templated1t9ha2
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases G proteins
Resolution1.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20....... ..30.........40.........50......
Predicted Secondary structure 








..








Query SS confidence 


















. .




























Query Sequence  ALVIDLGAQKRPTVISVVG. . AGGKTSLLFWLAELLQASGRRVLITTTTH
Query Conservation      
  
 
   





..







  

 
    
  






 
Alig confidence 


















..










.............




Template Conservation   

  
   
       

 









 
.............  

 
Template Sequence  DSLADIIPHFQDKTTVFAGQSGVGKSSLLNAI. . . . . . . . . . . . . SPTRH
Template Known Secondary structure  TT
TTTGGGGTTSS.............




Template Predicted Secondary structure 











.............



Template SS confidence 

















































   153......160.........170.........180.... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions