Return to main results Retrieve Phyre Job Id

Job DescriptionQ46809
Confidence86.40%DateThu Jan 5 12:34:36 GMT 2012
Rank388Aligned Residues33
% Identity30%Templatec1t9hA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:probable gtpase engc; PDBTitle: the crystal structure of yloq, a circularly permuted gtpase.
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20....... ..30.........40.........50......
Predicted Secondary structure 








..








Query SS confidence 
















. .




























Query Sequence  VIDLGAQKRPTVISVVG. . AGGKTSLLFWLAELLQASGRRVLITTTTH
Query Conservation    
  
 
   





..







  

 
    
  






 
Alig confidence 
















..










.............




Template Conservation 
  
   
  
     
 









 
.............  
  
Template Sequence  LADIIPHFQDKTTVFAGQSGVGKSSLLNAI. . . . . . . . . . . . . SPTRH
Template Known Secondary structure 
TTTGGGGTTSS.............




Template Predicted Secondary structure 








.............



Template SS confidence 















































   155....160.........170.........180.... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions