Return to main results Retrieve Phyre Job Id

Job DescriptionP0AGI4
Confidence2.20%DateThu Jan 5 11:29:15 GMT 2012
Rank98Aligned Residues22
% Identity32%Templatec3t5sA_
PDB info PDB header:immune systemChain: A: PDB Molecule:macrophage migration inhibitory factor; PDBTitle: structure of macrophage migration inhibitory factor from giardia2 lamblia
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   267..270.........280 ........
Predicted Secondary structure 


........



Query SS confidence 













. . . . . . . .







Query Sequence  RIYAIGGNLEAARL. . . . . . . . SGINVERT
Query Conservation   
 


 
  

  ........ 



   
Alig confidence 













........







Template Conservation   
 


 
   
  
   
   


  


Template Sequence  DFYCIGKNPSISAAITGCLTQHFKVKPERV
Template Known Secondary structure 







GGG
Template Predicted Secondary structure 








Template SS confidence 





























   61........70.........80.........90
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions