Return to main results Retrieve Phyre Job Id

Job DescriptionP76616
Confidence48.99%DateThu Jan 5 12:25:01 GMT 2012
Rank489Aligned Residues52
% Identity15%Templatec3l8aB_
PDB info PDB header:lyaseChain: B: PDB Molecule:putative aminotransferase, probable beta-cystathionase; PDBTitle: crystal structure of metc from streptococcus mutans
Resolution1.54 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   229230.........240.........250.........260.........270.........280.........290.........300.......
Predicted Secondary structure 






































Query SS confidence 














































































Query Sequence  QIRENMSEFARCHYGYIQIPPVTTFRADGPETPEEEKGYWFHAYQPEDLCTIHNPMGDLQDFIALVKDAKKFGIDIIPD
Query Conservation   
      
   

  
   
                  






 

  


 


 



 

 



 






Alig confidence 






















...........................




























Template Conservation 
                      ...........................



          
   
      

 
Template Sequence  DFEQLEKDIIDNNVKIYLLCSPH. . . . . . . . . . . . . . . . . . . . . . . . . . . NPGGRVWDNDDLIKIAELCKKHGVILVSD
Template Known Secondary structure 
TTSSB...........................TTTTB


T
Template Predicted Secondary structure 










...........................










Template SS confidence 














































































   148.150.........160.........170 .........180.........190.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions