Return to main results Retrieve Phyre Job Id

Job DescriptionP76616
Confidence96.66%DateThu Jan 5 12:25:01 GMT 2012
Rank152Aligned Residues57
% Identity14%Templatec3l55B_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:b-1,4-endoglucanase/cellulase; PDBTitle: crystal structure of a putative beta-1,4-endoglucanase /2 cellulase from prevotella bryantii
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   231........240.........250.........260.........270.........280.........290.........300........
Predicted Secondary structure 






































Query SS confidence 













































































Query Sequence  RENMSEFARCHYGYIQIPPVTTFRADGPETPEEEKGYWFHAYQPEDLCTIHNPMGDLQDFIALVKDAKKFGIDIIPDY
Query Conservation        
   

  
   
                  






 

  


 


 



 

 



 







Alig confidence 


















..................










.




..





















Template Conservation        
   


 




.................. 
         .     ..   
   
  
   

 




Template Sequence  QDXXTFLXQNGFNAVRIPV. . . . . . . . . . . . . . . . . . TWYEHXDAEGN. VDEAW. . XXRVKAIVEYAXNAGLYAIVNV
Template Known Secondary structure  TT

..................

GGGB
TT

.B
..T

Template Predicted Secondary structure 




..................






.

..


Template SS confidence 













































































   55....60.........70... ......80.... ..... 90.........100.........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions