Return to main results Retrieve Phyre Job Id

Job DescriptionP76616
Confidence91.49%DateThu Jan 5 12:25:01 GMT 2012
Rank211Aligned Residues47
% Identity21%Templatec2wnwB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:activated by transcription factor ssrb; PDBTitle: the crystal structure of srfj from salmonella typhimurium
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   652.......660.........670.........680.........690.........700.........710.........720.........730.
Predicted Secondary structure 











































Query SS confidence 















































































Query Sequence  VLAFSRGDSVNINHSPHDGLVIINKGNEEVEGTWPNKLQPGIYKNMGSNSVNIIINNTRKIIPPGKVFTLRGGTLNINIP
Query Conservation 



 


        
 





        
  
 
  
 
 

 
            
   


 

 

 





Alig confidence 







.......

















..................................












Template Conservation    
   

.......
  


  
         ..................................
   
      

Template Sequence  EVGFVNPD. . . . . . . GERVLVVYNRDVQERRCR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . VLDGDKEIALTLP
Template Known Secondary structure 
TT.......S

SSS
..................................TT
Template Predicted Secondary structure 


.......






..................................



Template SS confidence 















































































   395....400.. .......410.........420 .........430...
 
   732.......
Predicted Secondary structure 

Query SS confidence 







Query Sequence  GRSALLLG
Query Conservation 
 




 
Alig confidence 







Template Conservation 
 

 
 
Template Sequence  PSGASTLL
Template Known Secondary structure  TT
Template Predicted Secondary structure 


Template SS confidence 







   434.....440.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions