Return to main results Retrieve Phyre Job Id

Job DescriptionP76616
Confidence72.08%DateThu Jan 5 12:25:01 GMT 2012
Rank319Aligned Residues51
% Identity20%Templatec2qw5B_
PDB info PDB header:isomeraseChain: B: PDB Molecule:xylose isomerase-like tim barrel; PDBTitle: crystal structure of a putative sugar phosphate isomerase/epimerase2 (ava4194) from anabaena variabilis atcc 29413 at 1.78 a resolution
Resolution1.78 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   228.230.........240.........250.........260.........270.........280.........290.........300....
Predicted Secondary structure 






































Query SS confidence 












































































Query Sequence  QQIRENMSEFARCHYGYIQIPPVTTFRADGPETPEEEKGYWFHAYQPEDLCTIHNPMGDLQDFIALVKDAKKFGIDI
Query Conservation    
      
   

  
   
                  






 

  


 


 



 

 



 



Alig confidence 
























..........................

























Template Conservation    
   
  

  






     ..........................          
  


  
   

 
Template Sequence  RIVVAHIKKLQRFGYSGFEFPIAPG. . . . . . . . . . . . . . . . . . . . . . . . . . LPENYAQDLENYTNLRHYLDSEGLEN
Template Known Secondary structure  TT





..........................
GGGTTTTT
Template Predicted Secondary structure 







..........................










Template SS confidence 












































































   30.........40.........50.... .....60.........70.........80
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions