Return to main results Retrieve Phyre Job Id

Job DescriptionP76616
Confidence92.73%DateThu Jan 5 12:25:01 GMT 2012
Rank203Aligned Residues59
% Identity14%Templatec1j0yD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:beta-amylase; PDBTitle: beta-amylase from bacillus cereus var. mycoides in complex2 with glucose
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   225....230.........240.........250.........260.........270.........280.........290.........300....
Predicted Secondary structure 








































Query SS confidence 















































































Query Sequence  ATYQQIRENMSEFARCHYGYIQIPPVTTFRADGPETPEEEKGYWFHAYQPEDLCTIHNPMGDLQDFIALVKDAKKFGIDI
Query Conservation       
      
   

  
   
                  






 

  


 


 



 

 



 



Alig confidence 






















.







.....






.......


..........















Template Conservation   
 
    


 

 



 
 
.

 

 

.....
  

 
.......


.......... 

 




  




Template Sequence  TNWETFENDLRWAKQNGFYAITV. DFWWGDME. . . . . KNGDQQF. . . . . . . DFS. . . . . . . . . . YAQRFAQSVKNAGMKM
Template Known Secondary structure  S
TT.T.....
SSTT

.......

..........TT
Template Predicted Secondary structure 





.
.....






.......
..........


Template SS confidence 















































































   26...30.........40........ .50...... ...60... ... ...70.........80..
 
   305.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  IP
Query Conservation 

Alig confidence 

Template Conservation 

Template Sequence  IP
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   83.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions