Return to main results Retrieve Phyre Job Id

Job DescriptionA5A625
Confidence2.36%DateThu Jan 5 10:55:29 GMT 2012
Rank59Aligned Residues29
% Identity34%Templatec3lsnA_
PDB info PDB header:transferaseChain: A: PDB Molecule:geranyltranstransferase; PDBTitle: crystal structure of putative geranyltranstransferase from pseudomonas2 fluorescens pf-5 complexed with magnesium
Resolution1.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60.........70.........80....
Predicted Secondary structure 













Query SS confidence 








































Query Sequence  NDNKEFLTSLSNIMRYKIDAGLSESYTCYLLSKGKIIRPYL
Query Conservation 








































Alig confidence 




















............







Template Conservation           
     
    
............





 
Template Sequence  TAPSPELARLYEAXRYSVXNG. . . . . . . . . . . . GKRVRPLL
Template Known Secondary structure 

SSGGGTTT............


Template Predicted Secondary structure 









............


Template SS confidence 








































   23......30.........40... ......50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions