Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence35.25%DateThu Jan 5 12:37:36 GMT 2012
Rank128Aligned Residues30
% Identity20%Templatec3qj4A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:renalase; PDBTitle: crystal structure of human renalase (isoform 1)
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30........ .40....
Predicted Secondary structure 











..

Query SS confidence 





































. .





Query Sequence  MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYG. . IQPGCI
Query Conservation 
  
  

   

          

   
 
  
  

..  
   
Alig confidence 







..............















..





Template Conservation 
 

 


..............

 


  
  
   
    
 
 
Template Sequence  MAQVLIVG. . . . . . . . . . . . . . AGMTGSLCAALLRRQTGPLYLAVW
Template Known Secondary structure 

..............
SS



Template Predicted Secondary structure 



..............






Template SS confidence 













































   1....... .10.........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions