Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence39.37%DateThu Jan 5 12:37:36 GMT 2012
Rank118Aligned Residues30
% Identity23%Templatec3lovA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:protoporphyrinogen oxidase; PDBTitle: crystal structure of putative protoporphyrinogen oxidase2 (yp_001813199.1) from exiguobacterium sp. 255-15 at 2.06 a resolution
Resolution2.06 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30....... ..40....
Predicted Secondary structure 










..


Query SS confidence 




































. .






Query Sequence  MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRY. . GIQPGCI
Query Conservation 
  
  

   

          

   
 
  
  
..
  
   
Alig confidence 







..............














..






Template Conservation   
 




..............

 





  
     
  
 

Template Sequence  SKRLVIVG. . . . . . . . . . . . . . GGITGLAAAYYAERAFPDLNITLL
Template Known Secondary structure  S

..............
B
TTS
Template Predicted Secondary structure 


..............





Template SS confidence 













































   3......10 .........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions