Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence32.99%DateThu Jan 5 12:37:36 GMT 2012
Rank133Aligned Residues30
% Identity20%Templatec2zxiC_
PDB info PDB header:fad-binding proteinChain: C: PDB Molecule:trna uridine 5-carboxymethylaminomethyl PDBTitle: structure of aquifex aeolicus gida in the form ii crystal
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40....
Predicted Secondary structure 

..











Query SS confidence 

. .









































Query Sequence  MK. . TLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation 
 .. 
  

   

          

   
 
  
  

  
   
Alig confidence 

..





..............





















Template Conservation 
  






..............

 


 


 


 
 




Template Sequence  VDEFDVVVIG. . . . . . . . . . . . . . GGHAGIEAALAAARMGAKTAMF
Template Known Secondary structure  GG

S
..............SSTT

Template Predicted Secondary structure 



..............





Template SS confidence 













































   5....10.... .....20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions