Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence23.38%DateThu Jan 5 12:37:36 GMT 2012
Rank182Aligned Residues38
% Identity21%Templatec2vxyA_
PDB info PDB header:cell cycleChain: A: PDB Molecule:cell division protein ftsz; PDBTitle: the structure of ftsz from bacillus subtilis at 1.7a2 resolution
Resolution1.7 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50..
Predicted Secondary structure 
















Query SS confidence 



















































Query Sequence  MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCITWVGDDDY
Query Conservation 
  
  

   

          

   
 
  
  

  
     

 
  
Alig confidence 







..............





























Template Conservation     
 


..............


 
 
 
  
          





  
Template Sequence  LASIKVIG. . . . . . . . . . . . . . VGGGGNNAVNRMIENEVQGVEYIAVNTDAQ
Template Known Secondary structure 


..............TT

S
SB
Template Predicted Secondary structure 

..............










Template SS confidence 



















































   11....... .20.........30.........40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions