Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence64.48%DateThu Jan 5 12:37:36 GMT 2012
Rank82Aligned Residues30
% Identity20%Templatec2i0zA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:nad(fad)-utilizing dehydrogenases; PDBTitle: crystal structure of a fad binding protein from bacillus2 cereus, a putative nad(fad)-utilizing dehydrogenases
Resolution1.84 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40....
Predicted Secondary structure 

.











Query SS confidence 

.









































Query Sequence  MK. TLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation 
 . 
  

   

          

   
 
  
  

  
   
Alig confidence 

.





..............





















Template Conservation 
 






.............. 
 


 

  

  
  
 

Template Sequence  MHYDVIVIG. . . . . . . . . . . . . . GGPSGLMAAIGAAEEGANVLLL
Template Known Secondary structure 


S
..............
STT

Template Predicted Secondary structure 




..............





Template SS confidence 












































   1........ 10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions