Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence57.95%DateThu Jan 5 12:37:36 GMT 2012
Rank88Aligned Residues30
% Identity30%Templatec2eq8E_
PDB info PDB header:oxidoreductaseChain: E: PDB Molecule:pyruvate dehydrogenase complex, dihydrolipoamide PDBTitle: crystal structure of lipoamide dehydrogenase from thermus thermophilus2 hb8 with psbdp
Resolution1.94 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40....
Predicted Secondary structure 

..











Query SS confidence 


. .








































Query Sequence  MKT. . LATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation 
  ..
  

   

          

   
 
  
  

  
   
Alig confidence 


..




..............





















Template Conservation 

 






..............

 


 

  
   
  
 

Template Sequence  MKTYDLIVIG. . . . . . . . . . . . . . TGPGGYHAAIRAAQLGLKVLAV
Template Known Secondary structure 

..............
STT

Template Predicted Secondary structure 




..............




Template SS confidence 













































   7..10...... ...20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions