Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence36.71%DateThu Jan 5 12:37:36 GMT 2012
Rank124Aligned Residues29
% Identity10%Templatec2cduB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:nadph oxidase; PDBTitle: the crystal structure of water-forming nad(p)h oxidase from2 lactobacillus sanfranciscensis
Resolution1.8 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30....... ..40....
Predicted Secondary structure 










..


Query SS confidence 




































. .






Query Sequence  MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRY. . GIQPGCI
Query Conservation 
  
  

   

          

   
 
  
  
..
  
   
Alig confidence 

.




..............














..






Template Conservation 

.




..............

 


 

  
     
  
 

Template Sequence  MK. VIVVG. . . . . . . . . . . . . . CTHAGTFAVKQTIADHPDADVTAY
Template Known Secondary structure 
.
..............
S
TT
Template Predicted Secondary structure 
.
..............





Template SS confidence 













































   1. ..... ..10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions