Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence25.05%DateThu Jan 5 12:37:36 GMT 2012
Rank169Aligned Residues30
% Identity23%Templatec1ryiB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:glycine oxidase; PDBTitle: structure of glycine oxidase with bound inhibitor glycolate
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40....
Predicted Secondary structure 

...











Query SS confidence 


. . .








































Query Sequence  MKT. . . LATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation 
  ...
  

   

          

   
 
  
  

  
   
Alig confidence 


...




..............





















Template Conservation 
    

 


..............


 


 
  

  
  
 

Template Sequence  MKRHYEAVVIG. . . . . . . . . . . . . . GGIIGSAIAYYLAKENKNTALF
Template Known Secondary structure 

S
..............
STT

Template Predicted Secondary structure 



..............



Template SS confidence 














































   1........10. ........20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions