Return to main results Retrieve Phyre Job Id

Job DescriptionQ6IFZ3
Confidence22.35%DateThu Jan 5 12:37:36 GMT 2012
Rank194Aligned Residues30
% Identity20%Templatec1m75B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:3-hydroxyacyl-coa dehydrogenase; PDBTitle: crystal structure of the n208s mutant of l-3-hydroxyacyl-2 coa dehydrogenase in complex with nad and acetoacetyl-coa
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40....
Predicted Secondary structure 













Query SS confidence 











































Query Sequence  MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCI
Query Conservation 
  
  

   

          

   
 
  
  

  
   
Alig confidence 







..............





















Template Conservation 







..............

 

  

   
  
  
 
 
Template Sequence  VKHVTVIG. . . . . . . . . . . . . . GGLMGAGIAQVAAATGHTVVLV
Template Known Secondary structure 


..............
STT
Template Predicted Secondary structure 
..............





Template SS confidence 











































   15....20.. .......30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions