Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA67
Confidence2.09%DateThu Jan 5 11:12:03 GMT 2012
Rank87Aligned Residues33
% Identity30%Templatec2kncB_
PDB info PDB header:cell adhesionChain: B: PDB Molecule:integrin beta-3; PDBTitle: platelet integrin alfaiib-beta3 transmembrane-cytoplasmic2 heterocomplex
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   244.....250.........260.........270.........280......
Predicted Secondary structure 






Query SS confidence 










































Query Sequence  MEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKE
Query Conservation 
 

   
     
 
        
  


 
         
 
Alig confidence 












..........



















Template Conservation 
 





 



..........



 






 

 



Template Sequence  LVVLLSVMGAILL. . . . . . . . . . IGLAALLIWKLLITIHDRKE
Template Known Secondary structure  ..........
Template Predicted Secondary structure  ..........
Template SS confidence 










































   694.....700...... ...710.........720......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions