Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD59
Confidence12.76%DateThu Jan 5 11:20:05 GMT 2012
Rank9Aligned Residues27
% Identity22%Templated1xg8a_
SCOP infoThioredoxin fold Thioredoxin-like YuzD-like
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   116...120.........130.........140.........150......
Predicted Secondary structure 



















Query SS confidence 








































Query Sequence  KTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNF
Query Conservation          


 

   


 
 
 



  


 

 
  
Alig confidence 








..............

















Template Conservation 








..............




 


        
Template Sequence  PTSKDIYDW. . . . . . . . . . . . . . LQPLLKRKYPNISFKYTY
Template Known Secondary structure 

..............
TTS
Template Predicted Secondary structure 


..............







Template SS confidence 








































   17..20..... ....30.........40...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions