Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD59
Confidence7.02%DateThu Jan 5 11:20:05 GMT 2012
Rank26Aligned Residues27
% Identity30%Templatec2yy8B_
PDB info PDB header:transferaseChain: B: PDB Molecule:upf0106 protein ph0461; PDBTitle: crystal structure of archaeal trna-methylase for position2 56 (atrm56) from pyrococcus horikoshii, complexed with s-3 adenosyl-l-methionine
Resolution2.48 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51........60.........70.........80.........90
Predicted Secondary structure 
























Query SS confidence 







































Query Sequence  VQGHKLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDC
Query Conservation 
 
 


 


 





   
   
  



  





Alig confidence 











.............














Template Conservation 






 



............. 













Template Sequence  VGAEKVPREVYE. . . . . . . . . . . . . LADYNVAIGNQPHSE
Template Known Secondary structure 
SS


.............
SSSSS


Template Predicted Secondary structure 




.............







Template SS confidence 







































   108.110......... 120.........130....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions