Return to main results Retrieve Phyre Job Id

Job DescriptionP15068
Confidence19.83%DateThu Jan 5 11:34:31 GMT 2012
Rank16Aligned Residues19
% Identity47%Templated2foka1
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain Restriction endonuclease FokI, N-terminal (recognition) domain
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90
Predicted Secondary structure 






Query SS confidence 



































Query Sequence  IDSWKADPELNNSSYMWNILIYAIPYTLYALAAGFL
Query Conservation 











  













 
 
 


Alig confidence 










.................







Template Conservation   





 


.................



 


Template Sequence  IDNWSSDGFLR. . . . . . . . . . . . . . . . . WAHALGFI
Template Known Secondary structure 

.................TTS
Template Predicted Secondary structure 





.................
Template SS confidence 



































   102.......110.. .......120
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions