Return to main results Retrieve Phyre Job Id

Job DescriptionP00944
Confidence36.38%DateThu Jan 5 10:57:16 GMT 2012
Rank62Aligned Residues29
% Identity10%Templatec3tdmD_
PDB info PDB header:de novo proteinChain: D: PDB Molecule:computationally designed two-fold symmetric tim-barrel PDBTitle: computationally designed tim-barrel protein, halfflr
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   74.....80.........90.........100.........110
Predicted Secondary structure 












Query SS confidence 




































Query Sequence  EALALAKRKADVAFEFFHKLHVPFYCFHDVDVSPEGA
Query Conservation 
    
      


 
 



    


 
  
   
Alig confidence 







........




















Template Conservation     
 
  ........    

  
    
   
   
Template Sequence  LLRDWVVE. . . . . . . . VEKRGAGEILLTSIDRDGTKS
Template Known Secondary structure  ........TT
SSSS
SSSS
Template Predicted Secondary structure 
........









Template SS confidence 




































   31....... .40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions