Return to main results Retrieve Phyre Job Id

Job DescriptionC1P612
Confidence0.65%DateThu Jan 5 10:56:08 GMT 2012
Rank83Aligned Residues25
% Identity36%Templatec3op0B_
PDB info PDB header:signaling protein/signaling protein reguChain: B: PDB Molecule:signal transduction protein cbl-c; PDBTitle: crystal structure of cbl-c (cbl-3) tkb domain in complex with egfr2 py1069 peptide
Resolution2.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20...... ...30........
Predicted Secondary structure  ...........


Query SS confidence 












. . . . . . . . . . .











Query Sequence  KTFTKIIFIFSVL. . . . . . . . . . . VFNDNEYKITDA
Query Conservation 












...........











Alig confidence 












...........











Template Conservation 
 



















 
   
  




 
Template Sequence  RQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKA
Template Known Secondary structure  SGGG


TTT


SS
Template Predicted Secondary structure 







Template SS confidence 



































   119120.........130.........140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions