Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionP0ACX5
DateThu Jan 5 11:19:21 GMT 2012
Unique Job ID12d21c351499129b

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template c3fxhA_
Top template information
PDB header:structural genomics, unknown function
Chain: A: PDB Molecule:integron gene cassette protein hfx_cass2;
PDBTitle: crystal structure from the mobile metagenome of halifax2 harbour sewage outfall: integron cassette protein hfx_cass2
Confidence and coverage
Confidence: 13.8% Coverage: 16%
11 residues ( 16% of your sequence) have been modelled with 13.8% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MGNRTKEDELYREMCRVVGKVVLEMRDLGQEPKHIVIAGVLRTALANKRIQRSELEKQAM
Secondary structure 








SS confidence 



























































Disorder  ???????





































?



?








Disorder confidence 



























































 
   .........
Sequence  ETVINALVK
Secondary structure 

SS confidence 








Disorder 






??
Disorder confidence 








 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 3fxh chain A

3D model

Region: 9 - 19
Aligned: 11
Modelled: 11
Confidence: 13.8%
Identity: 55%
PDB header:structural genomics, unknown function
Chain: A: PDB Molecule:integron gene cassette protein hfx_cass2;
PDBTitle: crystal structure from the mobile metagenome of halifax2 harbour sewage outfall: integron cassette protein hfx_cass2

Phyre2

PDB 2wl8 chain D

3D model

Region: 3 - 36
Aligned: 34
Modelled: 34
Confidence: 11.3%
Identity: 21%
PDB header:protein transport
Chain: D: PDB Molecule:peroxisomal biogenesis factor 19;
PDBTitle: x-ray crystal structure of pex19p

Phyre2

PDB 1s4n chain A

3D model

Region: 9 - 16
Aligned: 8
Modelled: 8
Confidence: 8.9%
Identity: 75%
Fold: Nucleotide-diphospho-sugar transferases
Superfamily: Nucleotide-diphospho-sugar transferases
Family: Glycolipid 2-alpha-mannosyltransferase

Phyre2

PDB 1xrx chain D

3D model

Region: 7 - 12
Aligned: 6
Modelled: 6
Confidence: 5.9%
Identity: 67%
PDB header:replication inhibitor
Chain: D: PDB Molecule:seqa protein;
PDBTitle: crystal structure of a dna-binding protein

Phyre2
1

c3fxhA_
2

c2wl8D_
3

d1s4na_
4

c1xrxD_



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1c3fxhA_



13.8 55 PDB header:structural genomics, unknown function
Chain: A: PDB Molecule:integron gene cassette protein hfx_cass2;
PDBTitle: crystal structure from the mobile metagenome of halifax2 harbour sewage outfall: integron cassette protein hfx_cass2
2c2wl8D_



11.3 21 PDB header:protein transport
Chain: D: PDB Molecule:peroxisomal biogenesis factor 19;
PDBTitle: x-ray crystal structure of pex19p
3d1s4na_



8.9 75 Fold:Nucleotide-diphospho-sugar transferases
Superfamily:Nucleotide-diphospho-sugar transferases
Family:Glycolipid 2-alpha-mannosyltransferase
4c1xrxD_



5.9 67 PDB header:replication inhibitor
Chain: D: PDB Molecule:seqa protein;
PDBTitle: crystal structure of a dna-binding protein

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite



Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
If you use the binding site predictions from 3DLigandSite, please also cite:
3DLigandSite: predicting ligand-binding sites using similar structures.
Wass MN, Kelley LA and Sternberg MJ Nucleic Acids Research 38, W469-73 (2010) [PubMed]
 
© Structural Bioinformatics Group
Imperial College London
Lawrence Kelley, Benjamin Jefferys
Disclaimer
Terms and Conditions
Component software
Template detection: HHpred 1.51
Secondary structure prediction: Psi-pred 2.5
Disorder prediction: Disopred 2.4
Transmembrane prediction: Memsat_SVM
Multi-template modelling and ab initio: Poing 1.0