Return to main results Retrieve Phyre Job Id

Job DescriptionP67697
Confidence69.38%DateThu Jan 5 12:10:47 GMT 2012
Rank262Aligned Residues37
% Identity22%Templatec3c3wB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:two component transcriptional regulatory protein devr; PDBTitle: crystal structure of the mycobacterium tuberculosis hypoxic response2 regulator dosr
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   85....90.........100.........110.........120.........130..
Predicted Secondary structure 
















Query SS confidence 















































Query Sequence  AFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKE
Query Conservation   
   



 


  



   
 
 
       
  
   
 


  
Alig confidence 

























...........










Template Conservation       
 

 


  
 

  

  
...........   
  

 
 
Template Sequence  GLLSEGLTNKQIADRMFLAEKTVKNY. . . . . . . . . . . VSRLLAKLGME
Template Known Secondary structure  TTT

T

...........TT

Template Predicted Secondary structure 










...........



Template SS confidence 















































   159160.........170.........180.... .....190.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions