Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACV8
Confidence10.78%DateThu Jan 5 11:19:11 GMT 2012
Rank23Aligned Residues23
% Identity52%Templatec1xfzA_
PDB info PDB header:lyase/metal binding proteinChain: A: PDB Molecule:calmodulin-sensitive adenylate cyclase; PDBTitle: crystal structure of anthrax edema factor (ef) in complex2 with calmodulin in the presence of 1 millimolar3 exogenously added calcium chloride
Resolution3.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.....
Predicted Secondary structure 





Query SS confidence 






































Query Sequence  LKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMN
Query Conservation   
  








 
 

  
 
  







 




Alig confidence 











................










Template Conservation              ................    
  

  
Template Sequence  LKSKQIAPEYKN. . . . . . . . . . . . . . . . YFQYLKERITN
Template Known Secondary structure  TSS


................
Template Predicted Secondary structure 




................
Template SS confidence 






































   736...740....... ..750........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions