Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACV8
Confidence5.34%DateThu Jan 5 11:19:11 GMT 2012
Rank43Aligned Residues23
% Identity35%Templatec1ohfB_
PDB info PDB header:virusChain: B: PDB Molecule:nudaurelia capensis omega virus capsid protein; PDBTitle: the refined structure of nudaurelia capensis omega virus
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60.........70....... ..80
Predicted Secondary structure 




...

Query SS confidence 

































. . .


Query Sequence  MNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQ. . . WGN
Query Conservation 














 



    




 



...


Alig confidence 









..............









...


Template Conservation    
 





.............. 



  


   


Template Sequence  VDNKEISLDV. . . . . . . . . . . . . . TNDLIVWLNNLASWRD
Template Known Secondary structure  TT




..............S
S
Template Predicted Secondary structure 


..............

Template SS confidence 







































   170......... 180.........190.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions