Return to main results Retrieve Phyre Job Id

Job DescriptionP71301
Confidence65.08%DateThu Jan 5 12:12:45 GMT 2012
Rank407Aligned Residues39
% Identity15%Templatec3fymA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: the 1a structure of ymfm, a putative dna-binding membrane2 protein from staphylococcus aureus
Resolution1.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   157..160.........170.........180.. .......190.....
Predicted Secondary structure 






.................



Query SS confidence 

























. . . . . . . . . . . . . . . . .












Query Sequence  AQGMQPKSIARIENCSVKTVYTHRRN. . . . . . . . . . . . . . . . . AEAKLYSKIYKLV
Query Conservation    
 
  


  
 

  

  
   .................
  


     

Alig confidence 

























.................












Template Conservation    


   

    

   
  

 
              
   
  


    

Template Sequence  RLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLI
Template Known Secondary structure  TT




TT
GGGSSSGGGTT

Template Predicted Secondary structure 


















Template SS confidence 























































   1014.....1020.........1030.........1040.........1050.........1060.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions