Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9J0
Confidence44.59%DateThu Jan 5 11:10:26 GMT 2012
Rank94Aligned Residues42
% Identity19%Templatec3d3rA_
PDB info PDB header:chaperoneChain: A: PDB Molecule:hydrogenase assembly chaperone hypc/hupf; PDBTitle: crystal structure of the hydrogenase assembly chaperone hypc/hupf2 family protein from shewanella oneidensis mr-1
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60.. .......70.........80.........90.........100.......
Predicted Secondary structure 






.



























Query SS confidence 


















.












































Query Sequence  GRVSRVLPGMQAAFVDIGL. DKAAFLHASDIMPHTECVAGEEQKQFTVRDISELVRQGQDLMVQV
Query Conservation 


  
 
 
 






 . 
 


   

                   
   
  
  




Alig confidence 


















.








......................













Template Conservation   




      
 

  

 
 
 
 

...................... 
 
 








Template Sequence  SQVVAVDNERQSVTVDTLGVRRDVSSHLX. . . . . . . . . . . . . . . . . . . . . . TEPLAIGDYVLIHI
Template Known Secondary structure  TTTTTT
TT
......................SS


TT




Template Predicted Secondary structure 






......................








Template SS confidence 
































































   7..10.........20.........30..... ....40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions