Return to main results Retrieve Phyre Job Id

Job DescriptionP33225
Confidence31.56%DateThu Jan 5 11:51:24 GMT 2012
Rank152Aligned Residues39
% Identity13%Templatec3iwfA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcription regulator rpir family; PDBTitle: the crystal structure of the n-terminal domain of a rpir2 transcriptional regulator from staphylococcus epidermidis to 1.4a
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   301........310.........320.........330.........340.........350.........360...
Predicted Secondary structure 



















Query SS confidence 






























































Query Sequence  LAHTLYSENLYDKNFLANYCVGFEQFLPYLLGEKDGQPKDAAWAEKLTGIDAETIRGLARQMA
Query Conservation 
   

   
 
  

   
 
       
    
    


 

 



    
  

   
Alig confidence 







..................



......


























Template Conservation 

 


  ..................    ......   

 


    

 


 

 



Template Sequence  IAQFILNY. . . . . . . . . . . . . . . . . . PHKV. . . . . . VNXTSQEIANQLETSSTSIIRLSKKVT
Template Known Secondary structure 
........................TT

TS
S
Template Predicted Secondary structure 
........................





Template SS confidence 






























































   22....... 30... ......40.........50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions