Return to main results Retrieve Phyre Job Id

Job DescriptionP75957
Confidence98.18%DateThu Jan 5 12:16:25 GMT 2012
Rank98Aligned Residues39
% Identity33%Templatec3qkuB_
PDB info PDB header:replicationChain: B: PDB Molecule:dna double-strand break repair rad50 atpase; PDBTitle: mre11 rad50 binding domain in complex with rad50 and amp-pnp
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........40.........50......
Predicted Secondary structure 


















Query SS confidence 


















































Query Sequence  LQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLG
Query Conservation 
    
   
        

  

  
  


  
 
 








  
 
Alig confidence 




....


.......










.



















Template Conservation 
 
 
....
  .......     
 
   .
 

 
 








 

 
Template Sequence  VTVKN. . . . FRS. . . . . . . HSDTVVEFKEG. INLIIGQNGSGKSSLLDAIL
Template Known Secondary structure  ....TT.......

S.
TTSS
Template Predicted Secondary structure 
....


.......






.





Template SS confidence 


















































   6...10 ... ......20.... .....30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions