Return to main results Retrieve Phyre Job Id

Job DescriptionP15034
Confidence8.83%DateThu Jan 5 11:34:21 GMT 2012
Rank89Aligned Residues40
% Identity20%Templatec2plwA_
PDB info PDB header:transferaseChain: A: PDB Molecule:ribosomal rna methyltransferase, putative; PDBTitle: crystal structure of a ribosomal rna methyltransferase, putative, from2 plasmodium falciparum (pf13_0052).
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   256...260.........270.........280.........290.........300........
Predicted Secondary structure 











Query SS confidence 




















































Query Sequence  DLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPG
Query Conservation 
 
  
 
    

 

  

  
 
                       



Alig confidence 









.............





























Template Conservation 
 

 
    .............  
           
    
  
   

 
Template Sequence  DIILSDAAVP. . . . . . . . . . . . . CIGNKIDDHLNSCELTLSITHFMEQYINIG
Template Known Secondary structure 




.............

S
Template Predicted Secondary structure 




.............








Template SS confidence 




















































   108.110....... ..120.........130.........140.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions