Return to main results Retrieve Phyre Job Id

Job DescriptionP75867
Confidence24.30%DateThu Jan 5 12:15:15 GMT 2012
Rank66Aligned Residues53
% Identity23%Templatec2c9kA_
PDB info PDB header:toxinChain: A: PDB Molecule:pesticidal crystal protein cry4aa; PDBTitle: structure of the functional form of the mosquito-larvicidal2 cry4aa toxin from bacillus thuringiensis at 2.8 a3 resolution
Resolution2.8 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   438.440.........450.........460.........470.........480.........490.........500.........510.......
Predicted Secondary structure 
























Query SS confidence 















































































Query Sequence  SASMAELCALISALADVPVNQSIAITGSVDQFGRAQPVGGLNEKIEGFFAICQQRELTGKQGVIIPTANVRHLSLHSELV
Query Conservation 




   





   

 
 






 
 
 






 





   
   

 
 





  
   
 
  

 
Alig confidence 













..................








...






.........













..



Template Conservation       


 

  
..................
   
    ...      
.........
  


       
..   
Template Sequence  SAYTIVVGTVLTGF. . . . . . . . . . . . . . . . . . GFTTPLGLA. . . LIGFGTL. . . . . . . . . IPVLFPAQDQSNTW. . SDFI
Template Known Secondary structure  TT..................T


TTTTT...TT.........
TTGGG

..
Template Predicted Secondary structure 
..................


............






..
Template SS confidence 















































































   71........80.... .....90... ......100 .........110.... ....
 
   518.520..
Predicted Secondary structure 
Query SS confidence 




Query Sequence  KAVEE
Query Conservation   

  
Alig confidence 




Template Conservation    

 
Template Sequence  TQTKN
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 




   119120...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions